DPCstruct | MC31420
Metacluster Properties and Pfam Annotations
| Number of structural domains | 157 |
|---|---|
| Mean domain length (aa) | 161 ± 35 aa |
| Standard deviation of domain lengths | 34.50 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 85.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 22.57 |
| Pfam Score | 76.62 |
| Assigned Pfam label(s) | PF21754- CL0340- CL0063- CL0099- PF02887 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6Q2XQ20 | 196-367 | MLSGETAKGDYPLEAVRTQHMIAREAEAAMFHRQVFEDLRRAAPHSTDPAEAIAIGAVEASFKILASAFIVLTNSGRSAHLISRYRP… |
| A0A2N1JEG5 | 942-1118 | VMLSGETAKGMYPTEAVKMMAETTYIAEQTLAYQALFNEMRALTRVPTNTNETIALVAVSASLEQKAGAILLMSTSGNTARLVSKYK… |
| A0A7W1EQ94 | 104-273 | None |
| A0A7C6P3H1 | 3-111 | None |
| A0A6P4E2G1 | 2-106 | None |
| A0A6P4EEM9 | 298-466 | None |
| A0A7S2U9B4 | 1-122 | None |
| A0A7C4I830 | 11-164 | None |
| A0A287AQJ5 | 960-1136 | None |
| A0A5J4ZAI5 | 397-560 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.