DPCstruct | MC3142
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 126 ± 7 aa |
| Standard deviation of domain lengths | 6.53 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 84.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 35.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X8C5M0 | 133-253 | TPPTLGEVADVIRRHASLLAAHFGEDKGMRDLRKHIAWYLHGFPAGSELRRALALVKTLDELDALLTRLDADVPFPPAAIGPRAGRD… |
| A0A163LBV6 | 247-364 | WLFAELSAALNGQQIATPPTLGEVTKIIARHAQLLAAHHGEMKGLRELRKHVSWYMRGFPVGSDLRVSMALVSTLSELDDLLGQLDH… |
| A0A6V8KN44 | 1-123 | None |
| A0A7S3EI47 | 58-187 | None |
| A0A1Q8BCR7 | 138-273 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.