DPCstruct | MC31418
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 109 ± 11 aa |
| Standard deviation of domain lengths | 11.37 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 31.25 |
| Pfam Score | 98.33 |
| Assigned Pfam label(s) | CL0743- CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C7LUK3 | 4-109 | TAAIRRQLKIKSGSAKRLYKEHRSYQREEEDLKRKLDGFRASGAEDWDINNARRMMEESAKMVTDTASRLGVIVQELREIILSAEKD… |
| A0A2N1J7Z9 | 5-104 | AAQKRQLSIKTGVVKRLSKEVHMYTDECKEQEAAVKKAIDEAQEPWEVRRQEGLLKDSAQMIPDTKRRLQDAVADISTFIEGLTEDS… |
| A0A445HTM8 | 83-180 | None |
| A0A453Q1R4 | 9-120 | None |
| D3AZ35 | 5-114 | None |
| A0A836L524 | 7-124 | None |
| A0A0V0QL29 | 20-137 | None |
| A0A1D2NE92 | 7-116 | None |
| A0A812IWI6 | 5-117 | None |
| L0B212 | 4-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.