DPCstruct | MC31416
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 127 ± 24 aa |
| Standard deviation of domain lengths | 23.55 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 85.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 21.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A380NS62 | 1-112 | MLIFIKSTRSEPIPAIAKNTVYLKEDNWDDFGFKTIFTIIVFDELGNRYDLGVTKIGYFGQSEGWTSEKIDKNFRSLPNEFFSVGQE… |
| A0A1R1LFF5 | 1-139 | MKVFYHKGDKWRWTPTRLETEQNMLALSFNNWDDYGIGTTLNAVLYIDGKNFLEFALKLLIEDDKYSPKKLNQLRDEGWDGFFPIPN… |
| A0A4P8K828 | 8-137 | None |
| A0A6L9MPF2 | 1-108 | None |
| N9H985 | 1-138 | None |
| B4EUP8 | 157-280 | None |
| A0A6G2BJR6 | 1-100 | None |
| A0A318B9X1 | 1-203 | None |
| A0A6H3TVN0 | 1-126 | None |
| A0A6N2ZCC9 | 1-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.