DPCstruct | MC31415
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 120 ± 19 aa |
| Standard deviation of domain lengths | 19.12 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7D5BB23 | 13-108 | RILPDAVGHDLRPDPMTATTPAEFMELLRRYRIWSGQMSYREMALRSGRTVAASTFCTALRRDQLPKQSLLRTIIEVCGGTLAEQQT… |
| A0A562DNJ0 | 1-116 | MKVAEPTDSDGRPDPSAAGTAAEFVDALRRLKNWSGMGFRRLEQRAAATGQVLPRSTTTSALHRNTLPREDLIIALVRACGEDQDKV… |
| A0A347PU93 | 108-229 | None |
| A0A4R2JJT8 | 1-112 | None |
| A0A852UM14 | 113-239 | None |
| A0A0M8YGZ1 | 69-235 | None |
| A0A1H6DV98 | 1-120 | None |
| A0A5M7C655 | 8-115 | None |
| A0A1I3UPX5 | 16-139 | None |
| A0A652L5J5 | 12-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.