DPCstruct | MC31412
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 139 ± 31 aa |
| Standard deviation of domain lengths | 30.86 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 90.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 32.78 |
| Pfam Score | 97.06 |
| Assigned Pfam label(s) | PF13660- PF05161 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A800D7R3 | 18-157 | GEAREVGRVFAAVAKEIVHSGQPVPRPACVVAGGETTVTIRGQGKGGRNQELALAAALEIAGLEEAMVIGLATNGTDGPTDAAGALA… |
| A0A1F3NGS1 | 12-140 | FREMIYKYKNDNSLQKPVCLLFGGELTIRVTGKGAGGRNQHLALTAAMRLSGIPGIIFLSAGTDGNDGNTDMAGAVIDTDTMHDALS… |
| A0A2V7WQV9 | 37-197 | None |
| A0A136KYP9 | 1-101 | None |
| A6TL35 | 585-743 | None |
| A0A810Q683 | 321-464 | None |
| A0A2H0N7M1 | 158-306 | None |
| A0A6L5D8K4 | 263-351 | None |
| A0A7S2VYL3 | 13-135 | None |
| A0A653CUA4 | 2-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.