DPCstruct | MC31409
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 111 ± 10 aa |
| Standard deviation of domain lengths | 9.83 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 34.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E4ZTQ2 | 2-99 | ATDSCDCKTDDFPTVAIADYVLGCMAANGNSVESLHQCSCSVDFIKSKMSYAEFEEAQTIMQVQLDRGQRGIFFRDSHWAKERVKTL… |
| A0A5Q0BBI6 | 15-135 | FAVLPGCNRQQQAVTEKPLNDFPTQARVEYVFECMKDLGEQNYDNLYHCVCSIDKIASLMPYEDFSQAQTFSHFMGMAGDRGGEFRD… |
| A0A522VDM5 | 10-134 | None |
| A0A1E1VDC5 | 13-123 | None |
| A0A0D6PA93 | 62-170 | None |
| A0A2G2QHZ6 | 1-114 | None |
| A0A523K7N1 | 6-126 | None |
| Q1YFV5 | 139-241 | None |
| Q0G3J7 | 86-197 | None |
| A0A1Z9B8X8 | 23-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.