DPCstruct | MC31403
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 84 ± 10 aa |
| Standard deviation of domain lengths | 9.54 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 43.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0142 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R5JCZ8 | 9-90 | FWLLRPYQKDRIMMFLDPEMDALGAGWNIIQSKIAIGSGGFDGKGWGEGSQSHLNFIPEQTTDFAFSVLSEEFGWMGVALVL |
| W1VPX0 | 51-141 | GMPTYQINRILAWLNPFDYAQTTTYQQAQGQIAIGSGGIFGQGFNVSNLLIPVRESDMIFTVIAEDFGFIGSVVVVALYLLLIYRML… |
| A0A7J9YZV1 | 112-188 | None |
| A0A1G3L7Z8 | 274-357 | None |
| A0A845S5B7 | 8-88 | None |
| A0A2R7S7F3 | 33-122 | None |
| A0A822MN44 | 17-93 | None |
| A0A0A2WJH9 | 992-1099 | None |
| A0A3A1Y8W9 | 704-790 | None |
| A0A4U9TYC4 | 121-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.