DPCstruct | MC31402
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 79 ± 10 aa |
| Standard deviation of domain lengths | 9.79 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 89.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 49.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00384 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P9HF02 | 66-153 | LEFCENGAKALAHEATKFRVTREFFEKNTVSELMEQSDYWLEMQGRLTEPMRYDPSSDKYVPCSWDDAFALIGKHLRALESPDEAEFY |
| A0A4R5JCN5 | 1-74 | KLEFCENGAKALAWEATQFRAGRELFARHTVTELMAQTDYWLEMQGRLTEPMRYDAATDHYVPCSWDDAFALIG |
| A0A6I1IZ67 | 77-148 | None |
| A0A378B6A9 | 2-65 | None |
| A0A090MHB3 | 71-137 | None |
| A0A5N7ZT18 | 69-155 | None |
| A0A377BK41 | 75-149 | None |
| A0A1S7PD19 | 65-152 | None |
| A0A2V2KZG0 | 2-75 | None |
| A0A160NVE0 | 35-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.