DPCstruct | MC31401
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 91 ± 12 aa |
| Standard deviation of domain lengths | 12.09 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 93.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 49.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7MFP7 | 63-160 | IRRLVAVVGGSFGGMQVLEWAIRYPDYIGRGIVIAAAASLNAQALAFDIIGRRSITEDPRWRLGNYYASMRKPKLGLGQARRLAHIT… |
| A0A4R5JC92 | 1-82 | GSLGGMQALQWSVDYPDRLQKCVVIASAPKLSAQNIAFNEVARQSILSDPDFHHGRYLENDSYPKRGLILARMVGHITYLSE |
| R1G643 | 249-327 | None |
| A0A847BIL7 | 93-189 | None |
| A0A365VML0 | 70-150 | None |
| A0A378VWQ1 | 1-77 | None |
| A0A812KUX0 | 549-645 | None |
| A0A498GRK1 | 158-271 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.