DPCstruct | MC314
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 139 ± 9 aa |
| Standard deviation of domain lengths | 8.75 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 25.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| N9XV52 | 153-292 | KEVTDIEKNEFMKRCYNDILGIFKSLLSKSEEINQNFSYELEEITARKAIIKTFVNGTLVTGLKIWLGSSMGMRENSICISSGNWIN… |
| A0A4V3BUR8 | 1-159 | MKKDFDSIQKIEFQEKSFKDLSDIIRQNIDELQAIENVNGKILKSSAQEFEAILVNRNQIKSESTLNLNILKESNSSRFINRIDTSG… |
| A0A840A8A5 | 182-304 | None |
| A0A3M5FL21 | 122-257 | None |
| A0A355EWF5 | 1038-1175 | None |
| A0A451A366 | 252-392 | None |
| A0A6L8IPX8 | 337-474 | None |
| A0A7X7CIS3 | 1-135 | None |
| A0A6N2CPY2 | 100-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.