DPCstruct | MC31398
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 112 ± 13 aa |
| Standard deviation of domain lengths | 12.62 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 27.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A364YCS8 | 135-230 | RNLTPIEGVRTIIYNVSRKNPDLLWVGLNNRDKAWHDLYKLEISTGKLTLLKENKDRLTGYFFDWDENLRLATRSADDGSTEILAAT… |
| A0A7G9YFI0 | 1-137 | MNQGTGETSDLTPLEGVHARIQAVSQKFPGEILIALNDRDPTLHDIYRLNITTGEKSLVMENEGFMGFITDDKYNVRFAERLTPDGG… |
| A0A368FDV1 | 17-135 | None |
| A0A162BYE9 | 1-113 | None |
| A0A0D8XPV2 | 5-130 | None |
| A0A257MCC9 | 118-230 | None |
| A0A1Q8L215 | 685-785 | None |
| A0A838U4L3 | 69-169 | None |
| A0A7V9J3X9 | 1-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.