DPCstruct | MC31397
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 120 ± 10 aa |
| Standard deviation of domain lengths | 10.15 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 41.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G9YE53 | 1-134 | MPTLIRGVNDDQIGDIIRFASHNLDVVKGVNMQPVSFAGRINQEDREKWRFTIPDAFKCIEEQTDGEITRDDLYPVPCVVPISNFAE… |
| A0A7K3Y9Z9 | 235-351 | PTVINGRNDHEVGAIIRYAAEHIETIRGVNFQPVAFTGAASEDNVREERITIPGLADRIEEQTDGIIKKDYFYPVPCVVPISRLVEA… |
| A0A5E4IL05 | 13-139 | None |
| A0A497MPY9 | 404-521 | None |
| A0A662VQT3 | 455-570 | None |
| A0A1V5L2W6 | 30-143 | None |
| A0A6G1SZ20 | 1-112 | None |
| A0A497FMZ3 | 515-639 | None |
| A0A7G9YAJ2 | 80-212 | None |
| A1AQC7 | 237-334 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.