DPCstruct | MC3139
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 128 ± 17 aa |
| Standard deviation of domain lengths | 16.51 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 72.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 17.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0504 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R2G5E5 | 167-316 | KDSDDSKGSKYWFEPFYVTDDDSIKRFGVHDGGDVSDDRYHDVSAMTTYGKSKLVPEPSLAIEVTNNDNVEPNIEEIVRLEIRPFGY… |
| A0A7T9ZG45 | 7-151 | PSAEYSSPLKDIYGKIDAEPIQDDRFTDSNSLLEYLKTKLNDQPDIQYTMDFANFSKGAPLADFNNVSPGNYGWLRNRFGLDVEVRV… |
| W7Y9C6 | 55-197 | None |
| A0A1H2DRY3 | 46-187 | None |
| D5T0U1 | 183-337 | None |
| A0A842ZMY5 | 30-180 | None |
| H4GJE7 | 153-289 | None |
| W7E2I7 | 149-286 | None |
| A0A832I1B2 | 1-98 | None |
| A0A0R2BXR2 | 92-240 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.