DPCstruct | MC31389
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 172 ± 30 aa |
| Standard deviation of domain lengths | 30.10 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 69.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.70 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 31.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09791 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q9USH2 | 27-140 | FLAVEEGPASLRSYSIGNVSRIYDGIRVPPKPEEPLNCCQSGCAICVWDVYADDLEEYNRARRKAKRHYLDKHLPVPPDLAKVSLKE… |
| A0A2T0FEG3 | 28-197 | NDGVEAHGSKLVFNPSVYSSTEDMSTRAKRVFGDLGSREKSRSEAESKAVVVCGVKVPAQPEEPTNCCMSGCVNCVWELYKDEIEEW… |
| A0A1E3J0G7 | 1-203 | None |
| G0T188 | 1-158 | None |
| A0A6A6Q716 | 210-386 | None |
| A0A6A6ZDA3 | 28-211 | None |
| A0A7J6IKE7 | 1-122 | None |
| A0A5N6KR74 | 52-225 | None |
| A0A1V8UYF6 | 52-219 | None |
| A0A0D2I9K7 | 500-639 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.