DPCstruct | MC31387
Metacluster Properties and Pfam Annotations
| Number of structural domains | 114 |
|---|---|
| Mean domain length (aa) | 119 ± 25 aa |
| Standard deviation of domain lengths | 24.59 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 82.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 16.03 |
| Pfam Score | 97.83 |
| Assigned Pfam label(s) | PF15320- PF04654- CL0734 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T0FD43 | 2-126 | VRLKTRYLLFELLFPDSLDLAHPHESLRQTKSKIEYRKVADAFKQAVLEHSGEQGLGSVQSSLLVKYFSPATMTGVLRVSREYYRIV… |
| A0A7C5NZW5 | 2-94 | IAFQVIGERPFKKDEIKKALWGASLRTLGELGTARVKPWFIKFDEKTQTGIVRCDRKYVEELRFALTMITEINGSRAIIRTLGVSGT… |
| A0A7R9ZJR2 | 12-98 | None |
| D7KE60 | 1-98 | None |
| A0A1D1W8M4 | 1-130 | None |
| A0A523AM95 | 2-79 | None |
| A0A0D3CHI2 | 5-125 | None |
| A0A2G9NFE5 | 17-105 | None |
| J4UIV9 | 1-174 | None |
| A0A7C5RCI9 | 1-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.