DPCstruct | MC31386
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 200 ± 33 aa |
| Standard deviation of domain lengths | 33.21 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 74.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 24.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6B673 | 28-225 | ASGTTTALTTQRTPSDIPLAQPDRSGPKGKTLYDLAEERMAELQKQGQPFAKAPAGSDDEDFGPKAEALLWAFSLTMVHLTLDVLVH… |
| A0A2T0FCU9 | 1-151 | MTLFEQVQRRQAAGARSRPEPIDFDRTLLLAPLVLMHFVLAYLVRLQYSQEVSLSIALSESWVSIPVFWALLSLPRSYFNSKLSQAL… |
| A0A6A6Q401 | 4-210 | None |
| A0A0D7A8F3 | 4-199 | None |
| A0A0E9NQG0 | 102-266 | None |
| A0A2C5YE31 | 3-133 | None |
| A0A1Y1X8G3 | 5-184 | None |
| J4GFT1 | 1-188 | None |
| A0A1R1XAT0 | 38-240 | None |
| A0A3N4HY12 | 79-296 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.