DPCstruct | MC31382
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 223 ± 31 aa |
| Standard deviation of domain lengths | 31.46 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 72.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 20.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20248 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6YP77 | 1-274 | MSIFSSETLKDAPLVVRGAGFAFGVACKFVVENCTVVTATTKDEKADAKNSVKRSWNDSEDQRFYAKPMQVTEPLKSELEIKIYRVS… |
| A0A822L4T4 | 107-330 | SFLPAADAICTIAVKEGLVRKVNQDDKTDLGNINPKDFCLVTNSVIPIKTCNVNLNTQEINTQFGIGSMAVTASELISELTITINKN… |
| A0A6J4YDX8 | 403-637 | None |
| W9JPA2 | 241-510 | None |
| T2JXX6 | 1-200 | None |
| A0A1E7N723 | 714-940 | None |
| A0A5C6SYW5 | 214-373 | None |
| A0A369JME3 | 915-1152 | None |
| A0A017SGM8 | 1-202 | None |
| W9YN49 | 5-280 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.