DPCstruct | MC31381
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 115 ± 12 aa |
| Standard deviation of domain lengths | 11.74 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 66.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.78 |
| Mean length-normalized TM-Score | 0.32 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 43.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04667 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q2VAD1 | 1-128 | MDPPKKAPVPTEKDKRLLHMYGMIPTRRNLLHGQLEGRKYFDSGDFALSQARQPSNIGGVDTGSEHALRENISYPSAPVPSSSNVDN… |
| A0A6A6YNZ3 | 1-125 | MNPHQQNKVDISTLTPDEQRLFRLYGKLPNKKDLLQNKLKERKYFDSGDYALSKAGKASDIGVTSIGREHPVPEKIPHIAPQNQNVA… |
| A0A2U3DPY0 | 34-157 | None |
| A0A0J9XJY6 | 4-107 | None |
| A0A0J9XH55 | 4-109 | None |
| A0A2N1L6W4 | 13-115 | None |
| A0A2V1EBM0 | 1-115 | None |
| A0A238F822 | 1-115 | None |
| A0A1C3YIZ2 | 77-198 | None |
| A0A6A7ALJ7 | 1-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.