DPCstruct | MC3138
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 84 ± 5 aa |
| Standard deviation of domain lengths | 5.23 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 31.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L6HA76 | 4-88 | DARVILQRIQRYFKKIPNTYYAINIVDDRFDDCYNFFFIVHKKNSRPHSIPLRRVTPYDLESLKEVVREVREVYQLTIKYTGFTT |
| A0A7L5ULG6 | 10-93 | GKKICEQIARHFKQTRQTRYWIAIAYYSPNDCYNLFFNSRRPHHWQRSWPIAILNDLEFDELIAVLNVIRQQYHFTFEYSGFNH |
| A0A508YM15 | 5-93 | None |
| A0A0A1GU87 | 3-92 | None |
| A0A7Z2PGR3 | 1-70 | None |
| A0A0R1WW09 | 15-99 | None |
| K6QJ47 | 4-83 | None |
| A0A0R1P9A1 | 20-105 | None |
| A0A3Q8SN67 | 2-85 | None |
| A0A1B2A692 | 1-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.