DPCstruct | MC31373
Metacluster Properties and Pfam Annotations
| Number of structural domains | 70 |
|---|---|
| Mean domain length (aa) | 228 ± 67 aa |
| Standard deviation of domain lengths | 67.23 |
| Length coefficient of variation | 0.30 |
| Mean AlphaFold2 pLDDT confidence score | 73.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 23.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6YBB6 | 7-219 | YLFLTYQEDVKGILEKQLSPWAGDRLICLGDYARGHPDGILTVEEDEELIRQEFTLYDCMDRYSAHAGPDRFIGEMTERLVFGGRRS… |
| A0A6A6D6H6 | 2-116 | DTVWPKASKFYPSDQPCILRNLTTKDFVRSEPIALRPEYIHGPNIDFLGFGEVVLSRICWSTGSSISMEYDGNIHRGVWAGHCFDIT… |
| A0A0F7U486 | 9-98 | None |
| A0A4R0RE83 | 183-472 | None |
| A0A059JDX1 | 9-235 | None |
| A0A0F9ZX41 | 876-1105 | None |
| A0A3N4LGJ5 | 18-167 | None |
| A0A5C2TDI1 | 185-392 | None |
| K5UKJ9 | 21-277 | None |
| A0A1Y1W084 | 5-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.