DPCstruct | MC3137
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 102 ± 11 aa |
| Standard deviation of domain lengths | 11.46 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 40.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R0RYS3 | 283-385 | AYHQANKPATEQDEAVGHAVRAGYFYSGLADVARLTDDQDLADAAERLWRNIVDKKLYVTGGIGGTVDGEAFSYNYDLPNDSAYSET… |
| A0A2V2DZ69 | 1-103 | MGEYAQDHCPIELQSEAVGHAVRAALMYTGLAAVGMETGDRKYLDAAKRLWDNVVTTKLHISGGIGAEHKEEKFGSQYDLPNDAYLE… |
| A0A423VRT6 | 614-732 | None |
| A0A8A3PI57 | 152-259 | None |
| A0A7Z0CZF5 | 1-81 | None |
| A0A135V1Y9 | 245-358 | None |
| W0EV91 | 374-476 | None |
| X0PHH3 | 257-364 | None |
| A0A7C5QZM7 | 342-444 | None |
| L0EAI1 | 235-342 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.