DPCstruct | MC31369
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 306 ± 19 aa |
| Standard deviation of domain lengths | 19.00 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 73.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 21.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B2AN40 | 2-304 | VYETGLEHFQTLICQDQDQNYEGSSDPTMISCAGHAFHQLNLTLGHIKSKRMAGRIGSAFARGQRFSPPDPREASVGTHVSWSILNK… |
| C4JP91 | 270-590 | MVMPDGDDKESPFERRRKALQGDRSNASLKYFHQIHVFEQSIFALLDAISVNLGSAKRSGLPVDVFEASALIYETYVNGRLTLLCGG… |
| A0A175WCS8 | 1-277 | None |
| A0A428NVW9 | 209-521 | None |
| A0A4Q4W219 | 217-553 | None |
| A0A098CZV0 | 105-411 | None |
| A0A1S9E1N5 | 632-916 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.