DPCstruct | MC31368
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 230 ± 38 aa |
| Standard deviation of domain lengths | 37.98 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 73.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 17.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4D8XRD0 | 177-408 | SSLEGEVKELKRIVEQLMLRQDSMELENSNLRKALKAAKEEADMLRRLLAEEPTKYEKQGCSFSDVAAIHRPEKPNKQVRNMTPIEV… |
| A0A2T9YCB2 | 3-197 | AISPPAGLITASSKQPKVSYAEIARNLTTNKPKEETFRLHEAIRKCAGVKPLSSGTKAEQTHFISRIFVQGITRMPYKDLKQILFTM… |
| A0A1Y1VYX6 | 168-429 | None |
| A0A0B7NY50 | 672-848 | None |
| A0A0B7NXD2 | 8-281 | None |
| A0A0B7NQC3 | 33-275 | None |
| A0A163B3K9 | 107-325 | None |
| A0A2U1IWF9 | 69-351 | None |
| A0A163DXK3 | 40-273 | None |
| A0A1Y1VZK3 | 71-323 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.