DPCstruct | MC31365
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 221 ± 37 aa |
| Standard deviation of domain lengths | 37.31 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 22.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A316DTW2 | 145-382 | DKSGLIFLDDILEQFDYVGSGVFKSKSNEFSIFCHQYFNRNLSLINNFNTYFIDEFIRLNSEENVTLRIAIDRNLIGLSETFRGTLE… |
| A0A351QXN5 | 39-276 | NKYGLSLVNEAKFLRQGFIIDGRYYLYNIFFDTTIGAATDDIPYTIKIINEEIPARKLFLRCDEKVALPADRMISTATADFQKYRGI… |
| A0A5C8F8U3 | 160-388 | None |
| A0A1C2JLE2 | 13-212 | None |
| A0A7G6A7J4 | 19-185 | None |
| A0A399D3K4 | 46-261 | None |
| A0A2W5NJZ7 | 89-321 | None |
| F9N7F3 | 6-226 | None |
| A0A1J1EC03 | 39-275 | None |
| A0A443YSK7 | 102-363 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.