DPCstruct | MC31362
Metacluster Properties and Pfam Annotations
| Number of structural domains | 284 |
|---|---|
| Mean domain length (aa) | 93 ± 12 aa |
| Standard deviation of domain lengths | 11.89 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.34 |
| Pfam Score | 49.82 |
| Assigned Pfam label(s) | PF05638- PF07589- CL0220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A838R1W4 | 50-156 | GDVLEGAVNYVTGGFLAADFNSSGGVNAADLAAWKAGFGDVSAMKSDGDADNDLDVDGTDFLIWQRQLGQTGSASPTSAAVPEPASL… |
| A0A7C4VMH3 | 41-104 | GDINDDAQIDAVDATTLGVSFGNTGPNLPADINLDGAVDIFDIILLSVNFGQGQQVWNCLSAQP |
| A0A518AND8 | 868-965 | None |
| A0A518AK03 | 146-244 | None |
| A0A518AJS3 | 444-545 | None |
| A0A518AJH0 | 167-266 | None |
| A0A518AGZ2 | 337-433 | None |
| A0A517YX92 | 458-551 | None |
| A0A5K7X5V0 | 1092-1194 | None |
| A0A5K7XG25 | 273-380 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.