DPCstruct | MC3136
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 164 ± 16 aa |
| Standard deviation of domain lengths | 15.79 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 16.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A645C578 | 1-131 | MTAVVNPDGSVTYTMTRAQQKQMLDETKVNVQDSIAGFVNDPENSFTAVEVNDEMSQFTVKVDAARYSPLETLYGVVFYVSGGLYQQ… |
| A0A2V2DEF8 | 12-166 | SVEVTIPAIFYEYEEDGGEMTQEKVDQIVSDNGFKSGILNSDGSVTFSMSKSQHAEFLQSLKDATEETASDFVDGDDRIESFTKITF… |
| I5ASB5 | 124-290 | None |
| A0A2T3FZD7 | 12-165 | None |
| W5IHD9 | 232-404 | None |
| R6P9R0 | 24-214 | None |
| A0A1M7YN46 | 100-245 | None |
| A0A6B1S588 | 6-180 | None |
| A0A285RES9 | 31-207 | None |
| A0A7W0D675 | 3-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.