DPCstruct | MC31358
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 140 ± 21 aa |
| Standard deviation of domain lengths | 21.40 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 91.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 39.92 |
| Pfam Score | 95.83 |
| Assigned Pfam label(s) | PF20732- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y5W6Z6 | 11-144 | KTDDQTGAPVYALTRDCARVLPPAVHGAAAIVFAPTVSKDASDESFWFLTNVLGQTLQSASDNGLKYGVIDRPNPLERRRVEPMDLI… |
| A0A1E2SKM3 | 1-106 | MLSDVDALLFDIQDVGVRFYTYIWTLYLAMEAAGEAGVEVIVLDRPNPLGDRMDGPVLEPALASFVGLREIPLRHGLTVGELATLFA… |
| A0A2N0BCM6 | 54-248 | None |
| A0A2V5WTP7 | 95-218 | None |
| A0A136N795 | 91-204 | None |
| A0A816VWF4 | 69-194 | None |
| M6GGS5 | 3-117 | None |
| A0A2V7KLY1 | 287-417 | None |
| I0XB76 | 139-285 | None |
| A0A7J3ZBH4 | 46-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.