DPCstruct | MC31354
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 168 ± 25 aa |
| Standard deviation of domain lengths | 25.45 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 76.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 26.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y5SKJ5 | 1-178 | MKMRFWPLVGICLICSGCGTIGKCTPGKLLRTVFLEPAVYCEPKDDARSRAAYRRASEEAWNQVRQASAGTAFSHDFESGFKDGYSE… |
| A0A7C2P3I7 | 42-215 | YKPLCDNLVTKQTAVFCADKALKDLQKECGKQSSDFKYGFRDAYVDLAMGRPALVPPVPPRRYWNAYYRSCAGEPQVADWFEGYRTG… |
| A0A255R8R8 | 2-220 | None |
| A0A3B8L3C9 | 33-182 | None |
| A0A3B1DQQ6 | 123-277 | None |
| A0A2E7NW07 | 1-132 | None |
| A0A3B8ZJL4 | 39-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.