DPCstruct | MC3135
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 87 ± 9 aa |
| Standard deviation of domain lengths | 8.61 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 38.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W7BNZ0 | 12-92 | QRSAHIFRNAEGHFTEDNEINRQLLINTAMNKENYLGIDKWGNNWYATSLPNGQQIWVQIRKGEIINGGINSSSRLWFRST |
| A0A2V2C6G3 | 4-87 | ERSVSKHIFRNKKGHLSDTVENRKLLEDTANNKKNYLGKDKYGNEWYQKNLENGKQVWVEVRNGKIIDGGLNNIPKEWNPFTGL |
| A0A5N7ZAP4 | 51-144 | None |
| A0A0G0CQW7 | 876-962 | None |
| A0A4S2F256 | 13-107 | None |
| A0A3A9CP85 | 213-289 | None |
| A0A317JET2 | 31-119 | None |
| A0A317JG03 | 147-242 | None |
| A0A486XIG6 | 152-242 | None |
| A0A1H3WYX1 | 6-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.