DPCstruct | MC31342
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 349 ± 42 aa |
| Standard deviation of domain lengths | 42.23 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 15.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A651HBW8 | 1-412 | MRGRAWKGLGMGKQPIVPAGGWEVLADPEAVRHGVGLVFGARGGAAARLAETFHLRLLMARQLVQRVEAAVRLAKAPFLDLTPSAFR… |
| A0A3B1DAF4 | 76-460 | PLEILWLKWHVFSDLCHDVHVFHRDKKKPHLNISPQSVQISTPNLLSESLPARWVFSLALEKRKASRRFSSKEMPDDFCRQLFMPPK… |
| A0A139XDM0 | 219-521 | None |
| D8PEN3 | 1-368 | None |
| A0A318CXD6 | 340-693 | None |
| A0A7Y6Q0I5 | 3-308 | None |
| A0A6N2EMC1 | 247-650 | None |
| A0A4V1S978 | 11-289 | None |
| A0A7V0QJF1 | 84-431 | None |
| A0A150RH78 | 253-584 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.