DPCstruct | MC31338
Metacluster Properties and Pfam Annotations
| Number of structural domains | 74 |
|---|---|
| Mean domain length (aa) | 68 ± 11 aa |
| Standard deviation of domain lengths | 11.29 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 33.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0054 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A172WC56 | 3-54 | VDVQAKDCKRESNTFPGICLTKPPCRKACISEKFTDGHCSKILRRCLCTKPC |
| A0A061EJM1 | 78-141 | LLLIVLASQWVAQPAEGRVCESKSHKFKGPCLGDHNCALVCRNEGFSGGRCRGFRHRCFCTKLC |
| P84963 | 1-49 | None |
| A0A287XGW7 | 81-155 | None |
| A0A6A4PDY6 | 2-53 | None |
| A0A1U7W160 | 4-76 | None |
| A0A6I9UMP5 | 30-101 | None |
| A0A2T7F598 | 14-86 | None |
| A0A453PEL9 | 3-75 | None |
| A0A7G2EGQ4 | 113-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.