DPCstruct | MC31337
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 72 ± 7 aa |
| Standard deviation of domain lengths | 7.14 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 47.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05183 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5P1EUI3 | 775-846 | ALSTKCLKLANLHSMAVDYAKTGASAEMPSGLRPKRFPDFMERAEKPSYKSSGVLGKLYRAAINPHNISQNI |
| A0A2K3L7D9 | 200-266 | AMADPCIKLAKLFSTAVDFPKTGTPAEIPSHLFAREYPDFMEKLDKPTYKSKNVIGKLFREIQGIST |
| A0A2I0XAC1 | 1-80 | None |
| A0A0A9C0Y1 | 2-64 | None |
| A0A445MFI0 | 1-67 | None |
| A0A6P3Z5L6 | 35-112 | None |
| A0A2Z6REF5 | 144-219 | None |
| A0A0D8XSJ5 | 3-69 | None |
| A0A6A1UXT5 | 173-237 | None |
| A0A5N5H7E8 | 24-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.