DPCstruct | MC31335
Metacluster Properties and Pfam Annotations
| Number of structural domains | 803 |
|---|---|
| Mean domain length (aa) | 326 ± 93 aa |
| Standard deviation of domain lengths | 93.46 |
| Length coefficient of variation | 0.29 |
| Mean AlphaFold2 pLDDT confidence score | 86.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 16.01 |
| Pfam Score | 77.48 |
| Assigned Pfam label(s) | CL0023- CL0181- CL0277- CL0029- PF21307 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K3LJ71 | 1-142 | MKIRSGGHDYEGVSYVSKVPFFILDMFNLRSIDIDIDTESAWVQTGAQLGEVYYRIAEKSKIHAFPAGVCPTVGVGGHVSGGGYGNL… |
| A0A4D7CB51 | 7-327 | VEAASAIVRVANEYRVPLVPQAGNTGLVLGGAPDASGGEVVVSVERMNRIRSVDADDFSLVAEAGCILTEVQDAAAAVDRLFPLSLG… |
| A0A316ZNR6 | 189-590 | None |
| A0A212DNX6 | 2-300 | None |
| A0A6U5H377 | 212-649 | None |
| A0A317WZ55 | 580-799 | None |
| A0A814VW64 | 76-335 | None |
| A0A2B4ST37 | 177-610 | None |
| A0A6J4SZH6 | 1-283 | None |
| A0A5C6T890 | 309-586 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.