DPCstruct | MC31334
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 95 ± 9 aa |
| Standard deviation of domain lengths | 9.10 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 35.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4D7C8J1 | 1-107 | MLAPKLSDYIDFGPGFGPRVLVFVDTEEDFDWSQPMSRANTSVASVLHLERAQSLFRRYGIRPCYLVDYPIATAPTSIGVLRPWLER… |
| A0A084EFF7 | 13-118 | RAPLPEDMIALPAAFGTRFMLFVDTEEEFDWNAPFRREGHGVTALAGMARGQAYFAAAGVKPVYVTDYPVVDSDAAAGMMGAWVAAG… |
| Q4ACG9 | 1-78 | None |
| A0A377LP51 | 1-93 | None |
| A0A417WZK7 | 1-90 | None |
| A0A1G0QLL7 | 1-94 | None |
| C0ASE7 | 1-93 | None |
| A0A522AFE1 | 24-112 | None |
| A0A3D0W857 | 10-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.