DPCstruct | MC31320
Metacluster Properties and Pfam Annotations
| Number of structural domains | 94 |
|---|---|
| Mean domain length (aa) | 117 ± 30 aa |
| Standard deviation of domain lengths | 29.68 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 84.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 30.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0600 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0W0FX89 | 297-408 | LRELRKANMLAKVLDLRNANAEGIAYENRRRIIEAFSTPENPFDPGRQEVQAAILTYRIRNLWNHLSKFRRDVGNRRGLRQLVHQRA… |
| A0A3D3NFC2 | 24-124 | RGGADSKEREFDMAISVAQKAQIMTDYQRVAGDTGSSEVQVALLTARINDLTGHFKEHKKDNHSRRGLLRMVSRRRKLLDYLKRTNV… |
| A0A7I4BQG5 | 36-148 | None |
| A0A179I6H1 | 50-219 | None |
| T1KQQ2 | 103-238 | None |
| A9TLD1 | 113-245 | None |
| Q4UGY6 | 52-174 | None |
| A0A2M6YD59 | 13-100 | None |
| A0A7S4A3Z3 | 133-249 | None |
| A0A7S2S8K6 | 83-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.