DPCstruct | MC3132
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 99 ± 13 aa |
| Standard deviation of domain lengths | 13.37 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5Z203 | 11-105 | LVISLVPFCSAEDCKAGLDYCGWNLLQRSNYSDRIEAALLAKNQPTTVQQVDSSIFFCWQGGDIEFQVYCGNNNCQNGGTDRSDYCY… |
| A0A1F5LLF7 | 1-95 | MKFILPALTIFASLAVAKNCQEGLDYCSFTLMGKGDYHQQILKAIDEYGTDPKTVNYDYFLYHCDGGSNGSIHVKDTCSKGCHDGGD… |
| A0A369GQ85 | 2-98 | None |
| A0A369GKL3 | 1-120 | None |
| A0A5N5PD86 | 10-104 | None |
| A0A1C3YLZ4 | 46-148 | None |
| M1W1D8 | 1-81 | None |
| A0A179IAU1 | 13-105 | None |
| A0A6A5UUE9 | 2-79 | None |
| A0A7R7W6N4 | 98-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.