DPCstruct | MC31319
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 121 ± 11 aa |
| Standard deviation of domain lengths | 11.21 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 27.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A351KYZ1 | 3-126 | YSQLPPETRNDLDRRAGINRWANPQVGQAYTISSGGPRVPGRKTWNFHWAGVVMKSDDGRDNVTLENYSVSNYEAQNDQWIFQMYGS… |
| A0A351BGM2 | 154-280 | AMYLALGNAGMDKFDKEAGINFYANPEIGESYSMATEGDMPGFKSYPGRDTWNYHWAGVVMKDGADNITLENYAVTEKYAASKGVSQ… |
| A1ZJB4 | 43-160 | None |
| A0A355F2L3 | 301-426 | None |
| A0A355F5R4 | 95-224 | None |
| A0A3A8NSB9 | 146-252 | None |
| A0A3A8JKD7 | 39-154 | None |
| A0A5B2XIK0 | 477-590 | None |
| A0A7Y6XI30 | 346-463 | None |
| A0A6P0JZS4 | 106-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.