DPCstruct | MC31318
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 128 ± 19 aa |
| Standard deviation of domain lengths | 18.77 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 40.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A485NXE8 | 132-251 | MRTMDTKQLLNTLPVIQIQFDALLNFNANPDQLTNGIIHAAFMLLFKDSLRLFAAYNEGILNLLDKYFDMRKSQCKESLDICTKFLA… |
| E0W4G0 | 1-111 | MNAEKLLKTLPVLQSQVDSLLEFDCTANDLTNGVINMAFMLLFRDLIRLFACYNDGIINLLEKYFDMNKKQCRDALDLYKKFLIRMD… |
| A0A068YJ65 | 2-116 | None |
| A0A5J4NT80 | 15-124 | None |
| S9YKN5 | 32-144 | None |
| U4U6D0 | 57-193 | None |
| A0A814Z396 | 166-308 | None |
| A0A7J6ZB52 | 383-501 | None |
| E9IKC5 | 9-119 | None |
| A0A6A6MUL4 | 1-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.