DPCstruct | MC31317
Metacluster Properties and Pfam Annotations
| Number of structural domains | 81 |
|---|---|
| Mean domain length (aa) | 78 ± 12 aa |
| Standard deviation of domain lengths | 12.19 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 39.70 |
| Pfam Score | 97.96 |
| Assigned Pfam label(s) | CL0425- PF02580- CL0617 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A853QXL7 | 1-80 | MIALIQRVTRADVRVGGRTTGEIGAGLLALVCAERGDTEAAADKLLAKLLGYRVFSDAAGKMNLPVSNIDGEGRAGGLLL |
| A0A1F3R7S1 | 2-72 | KIVIQRVSQASVEINQQIKSKIDNGLLILLGIENDDTFEDVEWLCEKIASLRIFGDENGAMNLSVLEVKGL |
| A0A1A6A7L0 | 1-79 | None |
| A0A072PST1 | 1-80 | None |
| A0A1E4T396 | 252-338 | None |
| A0A3M0J044 | 1-80 | None |
| A0A834X9K3 | 240-330 | None |
| A0A3R8VVH8 | 632-741 | None |
| A0A395IKX6 | 1-80 | None |
| A0A377DE62 | 1-59 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.