DPCstruct | MC31310
Metacluster Properties and Pfam Annotations
| Number of structural domains | 88 |
|---|---|
| Mean domain length (aa) | 120 ± 18 aa |
| Standard deviation of domain lengths | 17.69 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 19.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0688 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0H4CE61 | 18-122 | QAKCQASDPDGRRIPTRLGNGELGWNHFSGKHNIKKCALVTIPLRDKVDKVDGANLQYWGWASHRAHGRVKIVVKARYARKTTDGRY… |
| A0A832U156 | 32-152 | ADLIVVAEKKGNLAKTIGIAKDGNNVRWLEEGTSSWGWTHIKNEHWTDLMNVFGPKTEQQVQEMILETIRSGEITKAIPGDQYKYTK… |
| A0A4R9BQS2 | 51-187 | None |
| A0A553GSQ8 | 3-141 | None |
| K2KTY4 | 72-206 | None |
| A0A2M9ADD4 | 10-140 | None |
| A0A2T6TPD9 | 72-206 | None |
| A0A1Q5KCX6 | 12-145 | None |
| A0A6A6YT07 | 18-104 | None |
| A0A7H8YUE1 | 149-280 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.