DPCstruct | MC3131
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 64 ± 3 aa |
| Standard deviation of domain lengths | 2.84 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 86.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 47.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0423 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F5LKV4 | 8-72 | QKLHEVLFEEGLKVRREVVGNSYVDRSLSNGSSDFAKPGQQLVTEWCWGHVWTRPGLERSQRSLL |
| A0A7G1IIL7 | 16-81 | GHLRRGDALYSAGMAMRREVLGDAHVERAIATTTAFTADFQDMITRNVWGGIWTRPGLDRRSRSLI |
| A0A7K3RQN7 | 213-275 | None |
| A0A2S1R4I2 | 124-186 | None |
| A0A4U0Y2F5 | 927-997 | None |
| A0A1Q2YU37 | 64-126 | None |
| A0A4D4L7C9 | 136-197 | None |
| J8VAT4 | 2-62 | None |
| A0A5B8NAN6 | 3-66 | None |
| A0A0U1M0Z2 | 11-72 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.