DPCstruct | MC31307
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 85 ± 6 aa |
| Standard deviation of domain lengths | 6.27 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 39.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A5K1B4 | 13-94 | VCIEDKVYPKINSFDNGQQKLVSIEDFCAKIRAAKATQKDSDFVLLARVEALIAGLGQDEAYNRACAYAQAGADAILIHSKQ |
| A0A067L3N3 | 168-253 | FLEDQAWPKKCGHFAGKQVIPAEEHAAKIASARDAIGNSDFFLVARTDARATSVEKGLSDAISRANFYLEAGADACFVEAPRDDDE |
| A0A7X6QCD5 | 495-582 | None |
| A0A7R9D7G9 | 177-270 | None |
| M3UPY1 | 108-188 | None |
| B1FH55 | 17-97 | None |
| A0A4Q7FRK1 | 39-119 | None |
| A0A0G0TXI4 | 264-342 | None |
| A0A1H6DXH6 | 83-162 | None |
| A0A7S2WWJ4 | 9-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.