DPCstruct | MC31303
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 147 ± 28 aa |
| Standard deviation of domain lengths | 28.28 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 85.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y5XMK7 | 110-221 | IRDGVDHDVPIDDPTDLSRTITDIDRPESGVLWEEKSAVNATDVDKWVNKQVIKKTEAYIAARQHIAGRENAPVGIDFTSPNPDPAF… |
| A0A1H7WTT3 | 249-417 | RGRGPLNNKHDDLGGSNSGASGDGRKSGDEGAGNVKQVKEVEIVDKNGRPIGELDEIDLKNGVFYEDKTAKGLNIVNPKTGLPAQTP… |
| A0A4R5E8B3 | 139-285 | None |
| A0A1G5FK48 | 519-662 | None |
| W4CIT0 | 387-592 | None |
| A0A2V4VWF8 | 47-219 | None |
| A0A3S5GY94 | 1-120 | None |
| A0A374HTM7 | 107-238 | None |
| A0A1B9EK85 | 480-606 | None |
| A0A4R4MMD6 | 266-424 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.