DPCstruct | MC3130
Metacluster Properties and Pfam Annotations
| Number of structural domains | 4 |
|---|---|
| Mean domain length (aa) | 177 ± 10 aa |
| Standard deviation of domain lengths | 9.90 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 69.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 44.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V6YN11 | 92-252 | SPAKYETESGLRWNRVVPAFNLLRNAGYEAQQPQPDGRLARSLYVNALVYLLDALPSDLTTEETSMLQRHIPEPVKVGLTTYPQPPG… |
| A0A1F5LJY1 | 1-177 | MGSPTKYEAESGLRWNRVVPAFNLLRNAGYEAQQPQADGRLARSLYVNALVYLLDALPPDLSTEETSMLEHHIPESVKASLAPYPQP… |
| A0A0F8UXA5 | 1-187 | None |
| A0A225A6F7 | 29-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.