DPCstruct | MC313
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 126 ± 14 aa |
| Standard deviation of domain lengths | 14.04 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V3BSG7 | 2-141 | SNIYKYKEDIDEISQVCDCPNSEYFQFEEKTAFRFVFEDSEHPHNFLPPAKIKPKRYLDKSPTEVCEGLGLSLYGKKYGARQKFEEL… |
| A0A3L9YRT7 | 75-201 | GAMTYREQLPESCPPQNARHPTESKLWRLLQQQRVTDRDFDSQYLKFPERNFPDMCGAKAVSLMTSLTICRAAAKSPRLKRAGFTHA… |
| E1YID1 | 9-122 | None |
| A0A7X0A7B4 | 2-143 | None |
| A0A6P1MS33 | 13-131 | None |
| A0A1M3II63 | 23-178 | None |
| A0A1C6IK65 | 25-144 | None |
| A0A4U7NA80 | 7-124 | None |
| A0A2A3UFN5 | 1-124 | None |
| A0A822MTY6 | 6-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.