DPCstruct | MC31298
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 135 ± 9 aa |
| Standard deviation of domain lengths | 8.89 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 30.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X8JWL5 | 1-130 | MLDFSAASGTGIELDNSVISSNAVQINGTNLTSSGYIVSRNNISFNVGNLRSANDTGIVICSSDGDININTSKAEIKGTLYAPNGTV… |
| A0A374E737 | 76-213 | IFDKIDSAYFSGNNIDEYSQDYTLEEINININDPLEVEGNATLTGNININTALKAFEDVTLNGEVKNTNNSVIFSKYGDIVIDSQNV… |
| A0A645A8W2 | 67-209 | None |
| A0A0K8J6R2 | 125-251 | None |
| E4SFQ4 | 117-259 | None |
| A0A374G2A1 | 21-133 | None |
| A0A7X4IC96 | 929-1055 | None |
| A0A1I6LDP9 | 94-233 | None |
| E6UJK0 | 88-231 | None |
| A0A373S820 | 112-256 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.