DPCstruct | MC31296
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 87 ± 12 aa |
| Standard deviation of domain lengths | 11.71 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 31.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4B0S2 | 17-97 | LRCRCLHLLALGPRSLGDLHKAMRAAQQQQQLSGVALDTALLKQTLAQVGELKASDRYHLRPEKLQEATEGWAHYTAAQRS |
| A0A822DG57 | 1-111 | MESGPQSSSPSHRPPVFLTPAAKKCNRVNGERRPLQEWLIHLLALKPCRKHDLIQRLEKSNMFPRDHTELLSALDEVGCLSPKDGKY… |
| A0A151P4R7 | 6-81 | None |
| A0A482WEZ8 | 1-87 | None |
| A0A091DM09 | 1-79 | None |
| A0A6I9V7X3 | 25-119 | None |
| A0A811TZ12 | 20-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.