DPCstruct | MC31293
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 107 ± 10 aa |
| Standard deviation of domain lengths | 10.45 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 34.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0671 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A822D1Y1 | 1-105 | RLFVHEVLRVFYDRLVDDQDRSWLYKLLKDVVKDHFKESFDSVFDNLKQDKKPLVEEDIRNLLFGDYMNPDLEGNERLYAEIPSVHQ… |
| A0A183KGY8 | 102-209 | LIPSSNMKEEDKLMRLWIHEVYRVFYDRLTMTEDENYFFDIIRQTCSDIFRTNIDKILSHLSLSGRVTDNDIRNLLFGNYIQDDSCY… |
| A0A4C1T0U6 | 40-162 | None |
| A0A811X8Z3 | 217-308 | None |
| A0A2H1CUY8 | 70-187 | None |
| A0A182SFH7 | 364-459 | None |
| A0A183WH21 | 5-103 | None |
| A0A4W3IE83 | 1-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.