DPCstruct | MC31291
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 241 ± 22 aa |
| Standard deviation of domain lengths | 21.69 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 72.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 29.70 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0718- PF17798 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A822CQV9 | 4-219 | YLPPTDEELAKKATKTEAFEVSQDEPGYYVRLGLLSTKVRKRSYQQVLTRVKDAKCRSQKAIAHLQSTVSLLDYARKNLNDASLKIH… |
| A0A674KAQ2 | 1-273 | MTSFVVTNSLNKAKAAGQLVASGVDAVLEKSQALVDHYLPLTNEELVKLAIAIEGFNMASVEEQKQRQSYFVRLGSLSNKVRHRAYQ… |
| A0A7J8BUB0 | 33-300 | None |
| A0A8B6C178 | 43-287 | None |
| A0A6P7E3G8 | 1057-1273 | None |
| A0A151P116 | 289-511 | None |
| A0A6P6LE70 | 71-312 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.